SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012485 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012485
Domain Number 1 Region: 10-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-19
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012485
Sequence length 230
Comment protein Name="PYU1_T012485" Note="Similar to Rbp1: RNA-binding protein 1 (Drosophila melanogaster)" AED:0.439647181369036 QI:0|0|0|0.33|0.5|0.66|3|0|230
Sequence
MSAASHDADDGADARDASRIYVGNLTPKANEVHLKKLFVKFGVILSIWVARKPPGFAFVH
FETREAAQRAVDAFEDAKESDRAMEILGKPVKVQMAGEKKKKAESTQDQVVARLLVRLQR
RLTSAQRKERSMIVTIICMNAVEGDLGSARALIRYIVTTTDLCRQHRQDTRVEAAVSRES
RDLVAPDPTVEATTDKREIENLIDDSGPIHGAGEGERNELVQVVAAAAEV
Download sequence
Identical sequences K3X5I6
PYU1_T012485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]