SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012505 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012505
Domain Number 1 Region: 98-151
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000524
Family Myb/SANT domain 0.015
Further Details:      
 
Domain Number 2 Region: 27-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000079
Family Myb/SANT domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012505
Sequence length 296
Comment protein Name="PYU1_T012505" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.0545640194763002 QI:0|0|0|0.5|0|0|2|0|296
Sequence
MSSSNDNRPLPALSPATSPAFRVATAPWTEDEHRRFLAGLETYGSGQTANPQAAWQSITA
AVRTRPIHDVKAHARRYFLELQMANTRKRKEDVAATQSQDSRWTLEEDARFEELLAYHSS
ASVCYPWDAIAAKLPGKTHRDARERYQKLCYDVARIEAGHHVSMSLSRSVSGNRGYDDMS
RSNQDAHCDDNDYTPTYECAVTLTSIEEKLLMRALGQVHVSSKTSPEVLTAIASTMAAFA
NSKDNKIPPQRTMPLFTLEDAQTALENVIQRQQTDVRVILETLIDSLKLQPPSPSN
Download sequence
Identical sequences K3X5K6
PYU1_T012505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]