SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012575 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012575
Domain Number 1 Region: 1-150,180-207
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.78e-57
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012575
Sequence length 213
Comment protein Name="PYU1_T012575" Note="Similar to Os03g0586800: Lysyl-tRNA synthetase (Oryza sativa subsp. japonica)" AED:0.124413145539906 QI:0|-1|0|1|-1|0|1|0|213
Sequence
EIRFRKKYLDLLTNPGVRPIFETRAKIVKGIRRYLEDRDFVEIETPMLFSAAGGAAAQPF
VTASRALGKDLYLRIAPELFLKQLVIGGFDRVFEMGKVFRNEGIDATHNPEFTMCEFYQA
YADYNSLMDTAEDMISGIVKDVTGGSFKIEYPIAVSGSEEAKSAEVIGEEEEASGEKKYK
MVEIDFTPPFKRLPILETLEEMIGEKLPDVNSS
Download sequence
Identical sequences K3X5S6
PYU1_T012575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]