SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012628 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012628
Domain Number 1 Region: 140-258,344-434
Classification Level Classification E-value
Superfamily alpha/beta knot 2.62e-48
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.00096
Further Details:      
 
Domain Number 2 Region: 242-325
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000411
Family Hypothetical protein MTH1 (MT0001), insert domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012628
Sequence length 444
Comment protein Name="PYU1_T012628" Note="Similar to C9orf114: Uncharacterized protein C9orf114 (Homo sapiens)" AED:0.200968577797391 QI:0|0|0|0.5|1|1|2|0|444
Sequence
MISSESSDEELETLHQTQVAARTTAKRAKKVKTAAQAEQTPAPQSKSATPTKKRSAESDS
ANADSATTASGSSNAQEQPKMSAAVAAVASAYEVTEDMTREQKKEIRKKRKLEMRALAAK
ELQDIVAKQEHDERRSKGRAWTLSMAIPGSIIDNAQTKELKTYLAGQVARAAVIFQVDEI
IVFDDQLGAAKNEGPQKKATDCHVFLQRILQYLETPQYLRRALFPMHSDLSCAGLLNPLD
CPHHLRSNEWSVYREGVVVDRPLKDKEGSHVHVGLQREVVVDKRIQTGIRVTVKIDEATK
DHKKKMMGKLVSSAEPREQLGVYWGYTSRFASSLSNVWQDSPFKGGYDLKIGTSERGHVS
VDDADFKLPAFRHALVVFGGVAGIEECVNADETIPASGEDSHSLFDMWVNTCPAQGSRTI
RSEEAVLISLASLRQHLTLSGKHA
Download sequence
Identical sequences K3X5X9
PYU1_T012628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]