SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012666 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012666
Domain Number 1 Region: 12-115
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000951
Family PLC-like (P variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012666
Sequence length 120
Comment protein Name="PYU1_T012666" Note="Protein of unknown function" AED:1 QI:0|0|0|0|1|1|2|0|120
Sequence
MLKKMKPEAAAGKRFLRVQAEGAQGIHASDSKFSRDAKPDPYVVFVLGNVAHKCENVNDV
EPLKYFAWPNAVKDFEIMQEKTLTESSLVIHVKDSDTIKDRYIGGASIPLGPLRGKIQAK
Download sequence
Identical sequences K3X617
PYU1_T012666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]