SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012709 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012709
Domain Number 1 Region: 200-310
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-20
Family Synaptotagmin-like (S variant) 0.04
Further Details:      
 
Domain Number 2 Region: 333-454
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000608
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 
Domain Number 3 Region: 487-693
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000232
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012709
Sequence length 771
Comment protein Name="PYU1_T012709" Note="Similar to Cpne5: Copine-5 (Mus musculus)" AED:0.229603138845085 QI:0|1|0|1|1|1|2|0|771
Sequence
MYYQQPPPASSPVGHDNRSLSAPSAPPADDSDPPSLYPLLSPTMPGGGGSFLYPRTNQQQ
QHMPYAASPGGITGPPVSIPMHPPQSTPPMNQQMPLSPVYSQSFSYQQQQRGSFTGSMPP
PSPVTTNQSFHQQQPQQQRASFNGGLAPPNPNLISGRTASGNGSLLQGGYGPVDPTLSIP
VTPLQNHPAAIPSSVVELRFRCKGLKKSDFLSESDPFLVVYLQEDARSWREIGRTETVVN
TADPTFTKAFHIDFFFEEVQRLRIEVFDRDSPSNKLSDHDFLGCVELTMGQLMSSKGQSM
LLSLLQKEKGRHVYGISGHVVISAEEVSTCSDMINVQFAGEKLDNKDGWFGASDPFLNIY
RIKDENADPASPSSWVHVWKSETIMDNLNPRWRMATLSVQLLCNGNLSRMLKFECMDWEN
SGRHQLIGVCTMTAAELVSGEKQRVDLINRERQLKKGKRYKNSGVLKLLHVECFKQHTFA
EFLRGGCEISLIVGIDYTASNGAASDPQSLHYIGGSYTGQGNDYQAAISATGAILEPYDA
DRKFPTYGFGGMVNGYVNHCFPLTFDPTQPEVEGVRGILQAYANSFQMVQLHGPTYFAPL
IRQAATIATHFSNPAAQPSMSDMNLKYFVLLIITDGAIMDMQATIDEIVQASFLPMSIVI
VGVGNADFSAMDTLDGDGKLLMDSRRRVAARDIVQFVPFNQFRNNPARLAKETLAEIPMQ
LVQHFKARGIKPHAPLERMGTDTLINSAMQGMNGNHVSVNQDRASFAGSQV
Download sequence
Identical sequences K3X660
PYU1_T012709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]