SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012711 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012711
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily F-box domain 0.00000000484
Family F-box domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012711
Sequence length 269
Comment protein Name="PYU1_T012711" Note="Protein of unknown function" AED:0.1 QI:0|0|0|1|1|1|2|0|269
Sequence
MLAQLPNECKQQIWRYLDAQELCRIACVSRGIARGANADVVWRVCMLAQLTQEQTRIAAH
RTPSECGLQRQHASRNLMGGHKATSSRGLTGNSETLTTAMSALCSNGHGEDGGEMAYGRI
ADDSTFWRDWYRNIFVSARCFYKANTSFEAAKTEILELKKERGELKEMLQAVKSKNQSDK
QLRRIQMSCVRWMNRSHRRQAASTSLQNAQTAALSKAEITEELHIVEANVQVQSRMIFSL
RSQYQKSLHRLTTQLARATQMLRDLEGSI
Download sequence
Identical sequences K3X662
PYU1_T012711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]