SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012717 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012717
Domain Number 1 Region: 406-695
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-76
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012717
Sequence length 1541
Comment protein Name="PYU1_T012717" Note="Similar to HERC2: Probable E3 ubiquitin-protein ligase HERC2 (Homo sapiens)" AED:0.0978828278050295 QI:0|0|0|1|0|0|2|0|1541
Sequence
MGIQVVFSLFASILDQASSSLTQKKEFLAELLPLIKSLPPQALAPTNCSIPSSLPGAAAQ
RGLTATASAATSDSRELVDKIQRFLLGVCPLPSLKPGPSSPKVYAVAPSLNDFDVTDRTN
AVNGLIYLAAARSSLRDFLIAMKVILGALESCCDANDTHSARLSSPLTTAVPLLKPKGED
QHPTNSAQSEWEKDEVAGKYKSKMDISSLDLKPGAARQRGDILASGKGVEHEISHSAPHD
LVIQVKRKALPKGFVPKAIGTTSTTTALNVSLAHHRPSGSQGAGVTNATTGVHKSKMKED
LKELRQSGSTGFSLDISMMEDSGSRDAFAVAINYAQTVKCPKLKPLNISSVLHQLDGAKA
SMPPKPTRFPRGTQQSSSSMKYEDVCSTSGIVLGDGMMLPGQDDCEDKEVWSCGQNSYGE
LGHGDTITRKSFDRIEALQRKDVVQVSAGNEHSIVLCGDGTVLTCGYNDNGQCGVGVTNR
VSNVTEIHKFGDHAISQVHAYNGCEHSVVVTQDGKAATFGYNYRGQLGHGNTTSENVPKL
IRSLEGKIVRLVSCSYYHTILTCEDAGAGRQFVYTFGRNDYGQLGHNDTIDRKVPHQIDA
LAEQQIVSVACGQYHTMVVSSTGKAYGFGKNDYGQLGTESAENQLVPVQVRNGLEKQMCL
EIRCGYYHTIVLCSGAHLYGFGRNDYGQLGLGKANATAAANLQLQQQRFASPQLIEELEG
KEIIRFACGCYHTIAVSDNGVLFVFGRNNHGQLGTGDTNERLYPFPIEYFLGKRIAMVAA
GFYHTIVLTGGKEEEKTDQDGEPGNMGDENVDGNLREPSVLCSSSILLTNSVRHILDTSK
SALSGEVGSGKLEKERAADQMEDSEDPSCDPDDEDCRDEDDRRRKAGVTVDNTPDLTDKS
VQHGVDSVDAAVIIFAELDRLCKPFLPKTGSYPILQHPSNTAMEAFRSTIQASPPPNIDL
CAIFDGCFEANVIHVCSSTFESLCTLLKHLSGRKIESLAHAQLHLQAAPQNGAQLQVYML
FVCLRLLQANLAQLLRSGLGKATMLFTMGRDTAMEIYDQAYAAVQGDPRFTTLEIERMLA
AIRQIRETLMALVGLKQRASSFLSADTEANNGEIVARIASDAVDTLMLGFELFFPCTCTQ
RQFFLHVIESRPEISKGDCACEGKVHLPTPGSHPKSRKLLLGPLLRRMAEDSLILKFLPL
AARDPLFQVDSSTKPNLSSISLIYTALLERIATEFTRALGEATNLQGGSSAMAADNSRHP
PLTFEPSLFNLLLVLQKHIAAWASSRTRWERKAHGHAHQALSMMERVAVLTDHVIRVDAK
EKDDIPLPWQCFIEFSLATLSQCCEVFRQVIFQESVPSPSFGHKYQDPSFAAGNEEIMID
NAFVEIVEASIVGQLLPSLVSSLLVFSSNPLFAATLFPSVKNLLRFLDDFNQHNQAIKDM
ENNRRGGHGGLISAAGAQSNSISGRRKQSGTLRLDFGRESELNASGVKRGSIGDVICLPW
SFLLEKDLAVLAAEMAVTLKIGDPFFTFENSQAAAHAISDK
Download sequence
Identical sequences K3X668
PYU1_T012717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]