SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012814 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012814
Domain Number 1 Region: 108-371
Classification Level Classification E-value
Superfamily DNase I-like 3.48e-34
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012814
Sequence length 388
Comment protein Name="PYU1_T012814" Note="Protein of unknown function" AED:0.0269922879177378 QI:0|-1|0|1|-1|1|1|0|388
Sequence
MNGFDSFFPSSSTPRNPYRHADYKRPRQPQSKQDRFFVVVGTLVCFALFVFWQGMPSSQS
PPALSIDSQAAAAAAALSGGDAAAAATQKSRPRLKGAQAAALSTTPLNFKVMTFNLRFAG
GSDGFNSWRYRKDHVADLINRYHPVIMGTQEGLKDQLAELASLLEHPYSRFGVEREENGE
FEQIFYDKTVLELLDSGDFWLSETPDTFGTKGWDAACVRLVTWGKFRVKATKQELFFFNT
QLDHVGPNSRAQGSRLLWQRIKTITQSNDAPLFLVGDFNTYRHTSTYSYFTTEFEGPKLL
EAWKEAESKIGTVSYTYHGWAGVDNDGERGAVVAENHIDWIFYRPQMKVVSTEVITESRN
GRYPSDHYPIQAEFLFPSPAELPPPSSS
Download sequence
Identical sequences K3X6G5
PYU1_T012814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]