SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012829 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012829
Domain Number 1 Region: 350-480,626-678
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-32
Family Ankyrin repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 11-106
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000011
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 3 Region: 106-190
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000168
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Weak hits

Sequence:  PYU1_T012829
Domain Number - Region: 1283-1340
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00575
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number - Region: 814-851
Classification Level Classification E-value
Superfamily WW domain 0.0778
Family WW domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012829
Sequence length 1655
Comment protein Name="PYU1_T012829" Note="Similar to Lor: Loricrin (Mus musculus)" AED:0.0112880067902557 QI:0|0|0|1|1|1|4|0|1655
Sequence
MAANNAVVEIPLEYRSHFSASQAEELISQFQQSDADGSGAIDEQEFRALLSRMAIIVTDT
EAAELVDSIDTDGNGFIDFRELVGMVIRIKTGDERFRGLKKFVDALDTTPIALLEREAKK
FGLQIVYQLIEERKATASTPPQFVMELTISGKWCGGAKGVEKLQAIGKTTRDAKFKAAEA
GIVRVKKLKPGLAYELGFLPPEWETWLFENLERGGKIKKLLQILSQKGFSPANSNLLMQK
ISTRVSSYRLRARRSAPTSMYYQEDTEKKSRMGESKVARVPANTLHPQWAHWSQQELERG
IHGRIVLDELIAFGYDPEKNPLFTQSLLRSASNTKSRDSPLKVNNNNAMTTDRGGFTFLR
CLEEGNQSEVELFVFAGQYVNARLVDTNSHVERTPLHIACRHGHAQIVRFLLKRGAEVDL
VDEFCRTPLMVAARSSYFDICEALLQHGASIFNVDNLHNTPLHMAAYGGCAKIVDLVLRV
HNNAMLLLFANLPQQRGVSYGSLLQTAYDTIMKRKLRDNERRRFHISWVLDAALWMHHQI
FDTEQEKQSGDSATARIRTPPAPQKHFMDHLLERYHGRLMKRAADDEEDGENTENQGKYT
DKDVIDWISLAEMTFYVDKCLREMYKHLCNKQGRTALHIACDENLVCTHELAIQCLVDKH
GCSPLVQDHSGKQPAELVLSFRGRPGSPKGDVALEMTHIHNREERVRLKKERDETERIAT
HRRIWQEAVETVAQDFNDLETLEKTKKLVKLQADMTKKQEINGWNVYEEPLSRNRLFENV
RSGFVQRQVPAQILATSTERLGWKEKLVLSSHFVERNRLQSEWEVHRVNSTDVYFFFNSE
RMHCQWVKPKEVPSEWRTKRIFDTDEQFEDEEDQASLVVKFSGDATAIMKDAARGRQLGP
WRECTCFDVTFYFHEETQRIALDKPPEVLQHESFWYAYALIRERSEEIEEHRGGWRRYYD
AVTSHTFFYDEFSGDCIHDTYATSEFLAGIHKSRPKPRFALTKEELQWRKEEEEWKSALQ
RARQRDEQKKEMAVQAEREVQQAEELSEELQKAIKKLEMSVTSEHLHEDAGKGLAYVDAR
YRRELAIFLKAQEDGLLTSINPARPNARDEIARSERLERELDDNEQESATIEDIDANRPN
RERRRVSRLVYRTVERMKLDLELCRWGCARWFPRVRSLEVHEREECERRRMVCRLGCGLV
KEHHQWRQMVYDHEAENQTFCDSRIVYCPRDCGVWMPHLELDRHMRELCMKRPVGDLRCR
LGCGMVYQGGAHQLLTLEQTRIAHEQDDCPLRKVECTWPKCKTIIMAKERNAHRHNHLIS
SGVVSFLTAEVHEYKVPKDMKLLKIQAWGAGGGSGHLKSQMVGHGGGGAFVEGICKVFPG
ETLYISIGSGGSSGKYARLKQCEYEEERKAEPTGMDETTLTKKSKRIETLVGVANGGYPG
GGRGHSGNKECACGGGGGFTSVYRESAYGVEYLLIAAGGGGGGTCRHGDGGGALKARQIK
DGDEMRTGRPGGDTFGGHAGECDEHNPICRFLGTDGISMQGGDGAEFGGGGGGGLFGGGG
GGFAPGIVGGGGGGSSFVNVPLFEAKSVHVEPGDAVLPGGMRENPPQSVRVAYWDVVDGV
VGEGGTSTVASLENGNHGGVRLARPGFFNDMKFHR
Download sequence
Identical sequences K3X6I0
PYU1_T012829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]