SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012866 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012866
Domain Number 1 Region: 195-311
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000294
Family Myb/SANT domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012866
Sequence length 902
Comment protein Name="PYU1_T012866" Note="Similar to GARP: Glutamic acid-rich protein (Plasmodium falciparum (isolate FC27 / Papua New Guinea))" AED:0.0497496268477057 QI:0|-1|0|1|-1|1|1|0|902
Sequence
MHHKQYPMKEMRGKISQEQCVQLASQMHKHFQLLMQNFHLFALPTDENMEAEEAAWRMAK
LGDDVTEYEAKEADPETRKQRKREALQECQKMMEELKVRGEKAQKCKEALLSKLNPSASQ
PNQDAISSRRVTRSLTAAHAAVAHPSMFELVGSNSLDELTSKFLNNCLVEERDLAIQDQM
LEIDKHLLLTQKKNPKKPFTPSEDKLLAHGVKRFHLDDESWVLIEKHFLPGKKLPVIRRR
FRYLTSNKTGMSAVKAYHSQFPKRRDASWILEEDLRIARGMIEFHNDSKRFARVGLKYLP
HRGRLEIRKRWERIRQKFEPEIAVQNPNIDDSSIDYAVLMKDLLEDKLREQVLRQSKKIV
EEPPQQAQNSLSYGTSKLGNQKKYVFRAAEKEYNADVSAIEMKLEDAPGQHQQQGDHTTN
GCQVKNLHPALFFTSWALINPSILLTRTCEHNWPSFIDELSGEPKEDDAASAAIMAGPTS
PAAEELSATDAQSTENEHVEEQSVDEPPLRSKQRVRTLPTRKKPSQQAAASTAQPKPPGK
KSVPKSADSESEPSMMANSSASCEDEDEDDSDYEHDELVSSENDQESDSEFEQMELSDDD
EDEEEHDDDDDDDNDDDFEYEELDDDDDEEDDETVAPAAVEVRQQGINPPKESTPPTRSA
RVAMTRAVPPAAASSGKKASPPLPKSSSPAPLRHPLRLQNLSKPGNERMKRALEALERRI
VGKSVGCSLSVADTNLAAAQRPRKPATRVAFSNEPLAPGRKRPDESRHNPFRVEIQAIGF
PKELDLETDEVLASSSGDDSFEREELRSSDDDEHPGAQAPAVHLDNGIEKGHSYMQDVAR
DMLISDSGWRPAKKPKLSCLPCEVCRNAPCVCANARRAQHVPQQRMRPSSASAIASSSSR
KA
Download sequence
Identical sequences K3X6L7
PYU1_T012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]