SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012867 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012867
Domain Number 1 Region: 14-92
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000326
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012867
Sequence length 200
Comment protein Name="PYU1_T012867" Note="Protein of unknown function" AED:0.590684020655019 QI:0|0|0|0.5|1|1|2|0|200
Sequence
MSDDEAASQERKSKRSSRHHADASQSVRVWLGHVPSSLCVHEEALRTLFAAFGPIHSIAI
HHDFVDMSTDGFVYLELSSQREAERLVAAVQSGTLSDGDDDNSSHHYGNMQARVAIARNG
GAQFDVDDEIANLLLGRRQAAVANPFSQHSVGDDEDERMLQSLSQHTFGSQPKRKKTKSA
TTRRKKQKAQETSFLSVNDE
Download sequence
Identical sequences K3X6L8
PYU1_T012867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]