SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012933 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012933
Domain Number 1 Region: 112-249
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000285
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 
Domain Number 2 Region: 436-509
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000077
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Weak hits

Sequence:  PYU1_T012933
Domain Number - Region: 311-380
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0198
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012933
Sequence length 533
Comment protein Name="PYU1_T012933" Note="Similar to FKBP4: FK506-binding protein 4 (Bos taurus)" AED:0.0124843945068664 QI:0|1|0|1|1|1|2|0|533
Sequence
MSAPLSASDMESLRAALLRVDKQTQAFLGPLLPLKAVQHVLLTFLRDRSRSFEEWVWDPS
VRQLLNQLREQNPEAHNQSQDVDLWFQRAAQDQWTYQYNRSDDVPSDQFAQQADAAQNDG
KVKFKKRDFYAASNAFKKSIECLEKYFEKEYYGETVEVHEWDEPMQERYVTLCCNIAVCG
IKMKELSLIKEYAQKALAVNASARKALYAMAKLHLMEHLYEDAFIVIDKALRYHPDNQDL
LKLRREVDQAREKESEEQAEVALAAKEKLAEEKLMQEEQAEKQKQWAEKRVTAQDFVPLP
TLEQDAFTTARLHTYFHRIKHVLRVDINQLSNPDKGEPPLFECTVSDGTTGVVLAANVQA
SSKKIVKNEACKVATQRLWDMKTEAGELLEEDQEYLKTFEQAKREGKTIASAAESNPMVQ
QSDAGKQTPSGPLKLSVFERQMDVVMLLNQLHVQKRLHVQFDIEDVSPKDTTEFQCTVLI
NGEQMGCARAISKKKARAQASKQALDTALEKNLVFYWTPREGDEYDDDVEASK
Download sequence
Identical sequences K3X6T4
PYU1_T012933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]