SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012939 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012939
Domain Number 1 Region: 126-216,369-419,499-725
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.89e-28
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Domain Number 2 Region: 226-290,327-365
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000549
Family Calcium ATPase, transduction domain A 0.01
Further Details:      
 
Domain Number 3 Region: 427-505
Classification Level Classification E-value
Superfamily HAD-like 0.000000000000795
Family Predicted hydrolases Cof 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012939
Sequence length 1002
Comment protein Name="PYU1_T012939" Note="Similar to ATP8A1: Probable phospholipid-transporting ATPase IA (Bos taurus)" AED:0.151068563971008 QI:0|0|0|1|1|1|2|0|1002
Sequence
MKSSEAASGDDTGGAVTPKVSTYVLLAPSPRQQTNQDHEAHDTLLDDVVDQNVVVLESAD
KPQKRRRPKNALDLIQEAPRASHEKSNYDDNENDSNNSNGEEENDDDDDEVYRYVYLNAP
QENAAQGYCNNTVVTSRFTVYNFLPKLLFYEFSKLANAYFLVISVMQTVKPISNTGGFPA
SLPALTIIVLIDMFFACLEDYKRHKADHIANELPCRKFSLEARAFEPSKWQHLHVGDVVK
LYNREAVPADLVILGASEPDSENPAGICYVETKSLDGETNLKLRQGLEATYTMLQRDEQI
ADLAGVVICETPNNSIHRFNGSLSLQNGAKEAITTNAIVLRGSTLRNTEYIYGLVVNTGP
DTKIMMASSNTPMKWSNMERRLNRQIMYICALMVVLCLTGATASAIWNHSNLSRDRGEGA
WYLFDKDTTAKAQLVHLVRDNNPEVRTLAIGDGANDVSMIQAAHVGVGISGQEGMQAANS
SDYAIAQFRFLSRLLLVHGRWNYVRMGKLILYIFYKNVMMNLTQFWYMIFTGFSGQKFFL
EWGLQGYNLLFTALPIVLISTLEQDVPAHLAHNYPLLYRIGQENSHFNTKIVWAWISSCV
WESLIISFGTLFGMRYLTEEGDTPTMWVYGCTAFTIVLLVVTLKLCLHQQMWWPAHLAIY
VCSVSLWVVTAAIISNGNSISSAYWNGVFSNSFGVQVFWLLVPLLTFTALSRDFLWKGYI
RAFRPSYKHLAQEVSAFGLTPLADKLLAFPPAETIPWGDMEAPVESVVEPPRRSRVSTSE
AIKMAVLSAAGAGSAISMPPRPLPSAFRLPPRKSVSRGSAFSYDAESVMVESFMATERYN
NQEYPQDARTLFERHASRGSMAFHGLPTSEAVAHALGVLNSSNGDDDSGAARPRGRERLH
SAGNIFRGARHSFVKRPRFGSASTVQGVTTNTNATTTRGSLVGSTSDVQSPSPYHQQQSA
ASSAASTPHTPGDVSFQQQQQQGSGRLVRRYTAPRYTRQMSA
Download sequence
Identical sequences K3X6U0
PYU1_T012939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]