SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013134 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013134
Domain Number 1 Region: 14-136
Classification Level Classification E-value
Superfamily ATP synthase D chain-like 7.85e-22
Family ATP synthase D chain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013134
Sequence length 175
Comment protein Name="PYU1_T013134" Note="Similar to At3g52300: ATP synthase subunit d, mitochondrial (Arabidopsis thaliana)" AED:0.16610455311973 QI:0|1|0.66|1|1|1|3|264|175
Sequence
MFKLRQQVVRRAVVAQRAIEWDAISQKLTDPRARAALDSLRNVHGEIQAEAREYLKEPEA
IDFDYYRSIIKNKDLVNALEENYKNIVFPTITPEELDTSEINEKETVDQLFAQLNEKVDD
SKKRIVELQELIGLMEETRTTLDTTVDEIAAMYPEVSEEIDDEIANYDWEKDTQG
Download sequence
Identical sequences K3X7D5
PYU1_T013134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]