SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013137 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013137
Domain Number 1 Region: 274-293,325-491
Classification Level Classification E-value
Superfamily RNI-like 4.06e-23
Family 28-residue LRR 0.019
Further Details:      
 
Weak hits

Sequence:  PYU1_T013137
Domain Number - Region: 206-246
Classification Level Classification E-value
Superfamily F-box domain 0.0392
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013137
Sequence length 512
Comment protein Name="PYU1_T013137" Note="Similar to RNH1: Ribonuclease inhibitor (Sus scrofa)" AED:0.0233918128654971 QI:0|-1|0|1|-1|1|1|0|512
Sequence
MNDEQPMITSPADTMDDGVGAITPSTVSSGVLPQWSQLMPDVQARKRIGTTPVSSSSSSD
SDEQDDDDELTTPWQSMNDLPERRVMVQRIITLTEKKSAIVAAQQQQQDQSAATLAKRIE
LSLYSRAHSLDEYRNLTTLRRRLQSLVALSYHEATAERAMQEQQQALSPKRRLLLARHLD
LTPDFNIKRRRVVVGLSDVEETKTNSSSSGGERGFLFQRIGDDCVRNIFSFLDGREVIAN
RVLSRFASEFLPSCILRLQLSVQQLQHCLDSDDLFSLYRLSNLEQLVITNSSSPQNPEQQ
QQHGVAGPLHAWGCAELDATQSNDGEYVVARLAAALDAGAGRHLKQLHLVSVFTNTRQRN
GVRALCDALAHGACPQLEDLLLGGNSITDAGTSHIARLLKVRDAVPRLARLDLRRNYIGE
AGLYKIVSALAKANTTQLRYLCLGGNVITDNCVPPLQELLLAGRACPQLRFLGLEDNFLS
PDGVQTIIQAAASSGMVPKLHRVCSSDDGAIL
Download sequence
Identical sequences K3X7D8
PYU1_T013137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]