SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013170 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013170
Domain Number 1 Region: 119-255
Classification Level Classification E-value
Superfamily Cap-Gly domain 7.85e-33
Family Cap-Gly domain 0.00012
Further Details:      
 
Domain Number 2 Region: 28-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.28e-17
Family Ubiquitin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013170
Sequence length 272
Comment protein Name="PYU1_T013170" Note="Similar to tbcb: Tubulin-specific chaperone B (Dictyostelium discoideum)" AED:0.249084249084249 QI:0|1|0|1|1|1|2|0|272
Sequence
MAEDLRTLRNYVTAKDGLEYENLPEGMVALHITHSNLRMQMVDIRLDLHLTIAEVRHKVY
RHSGTKPDSMELLIMGPDESVLARLDDDRKMLGYYSVQSGMRLHVIDKDPFSLSKGGGLE
DVSLIQKYEISEDDYNKREKTVRAYKKEQLAKDPNWKPKKMMNVTRPPVDPASVPGPETT
EGMSVGDRCEVQPGGRRGQVAYLGEIPEIAPGYWVGVKFDEPLGKGNGTVKGKVYFSCDD
KYAGFIRPHNVTVGDFPVEDPFADLDDSDDEL
Download sequence
Identical sequences K3X7H1
PYU1_T013170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]