SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013180 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013180
Domain Number 1 Region: 90-153
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000878
Family GARP response regulators 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013180
Sequence length 368
Comment protein Name="PYU1_T013180" Note="Similar to ARR18: Two-component response regulator ARR18 (Arabidopsis thaliana)" AED:0.263007633739341 QI:0|0|0|0.8|1|1|5|0|368
Sequence
MATAAATTTAPVIEPSNTPLQTTASYMSKSTDDGTSAAGAESACDGTPALRILKKTMSTE
SVLGDDKSNTGQSSSGGGTPNAARQRKYERKTKRFIWPDELHRLFVAAIFDVGLKNASPK
ALLGLMGVAGPDSGLTTEHLKSHLQKYRLNYERSRAEFLEFYDHSAKKNLKRRRKHGNKA
GESNTMFVFPIAPKKQKGDSDDSNDSNNENDDDAADESMSDAHTTPRSSITSSERTGSYS
NLLQEAKEQQQKASGYHASRSQHPQHIQNRLLESSSAGDRVNYSAMGASGAMSNQALQAA
AYAVSQRKASISGSNANGLNNRAIAAAAAAAFRYPMGMPIGPGNPTAALGDLSDPQWNIL
SSRRDPDE
Download sequence
Identical sequences K3X7I1
PYU1_T013180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]