SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013217 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013217
Domain Number 1 Region: 14-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.7e-23
Family Ubiquitin-related 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013217
Sequence length 107
Comment protein Name="PYU1_T013217" Note="Similar to SMT3: Ubiquitin-like protein SMT3 (Oryza sativa subsp. japonica)" AED:0.00619834710743805 QI:8|1|1|1|1|1|3|146|107
Sequence
MQNHSQLRSTMSDETPNDAANAGGEKKAEAITIRVKDQSGEETFFKVKPNTKMEKIFSAY
AQRKGVPVSALRFLLDGTRISGDQTPKMLELEDQDQIDCALEQVGGF
Download sequence
Identical sequences K3X7L8
PYU1_T013217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]