SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013231 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013231
Domain Number 1 Region: 38-226
Classification Level Classification E-value
Superfamily Cytochrome c 1.52e-64
Family Cytochrome bc1 domain 0.000000714
Further Details:      
 
Domain Number 2 Region: 227-269
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000000000196
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013231
Sequence length 270
Comment protein Name="PYU1_T013231" Note="Similar to CYCL: Cytochrome c1-1, heme protein, mitochondrial (Solanum tuberosum)" AED:0.0295202952029521 QI:0|0|0|0.5|1|1|2|0|270
Sequence
MNRLPQFLQRAAKVGAGALVGGSVLTGVTAFSGDQIEALHYGFDHEGPLSSFDYASVRRG
YQVYKEVCATCHSVERICFRNLVGVIFTEEEAKAAAADIDVIDGPNDEGEMFERPGKLSD
PLPKPYANDEAAAAANNSAIPPDLSLISKSRHGGPDYLFALLTGYVDPPEGKELLPGLYY
NPYFGGGAIAMERQLNDGQIEYADGTPATTSQMAKDVSVFLAWAAEPEHDVRKKQGFQTA
LALGAMVLLTGYYKRLKWAPLKTRKITYTK
Download sequence
Identical sequences K3X7N2
PYU1_T013231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]