SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013246 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013246
Domain Number 1 Region: 66-171
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.65e-23
Family Tryptophan biosynthesis enzymes 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013246
Sequence length 185
Comment protein Name="PYU1_T013246" Note="Similar to TRP1: Tryptophan biosynthesis protein TRP1 (Phytophthora parasitica)" AED:0.228336495888678 QI:0|0|0|0.33|1|1|3|0|185
Sequence
MSILDVITEQRRADVAAARLVVSEQQLRDQIRATEAALGPALDVLDRLNAPVKQGWSKIA
LAAEFKRASPSKGDIALELEIRGLANFLLLDTSVKGQQGGTGVTFDWRIAALFNQARLPC
LMAGGLTPENVSKAVSIARPLGVDVSSGVEVKGSPGVKNMAKVSAFLKAAKDFLSVASLK
IDEES
Download sequence
Identical sequences K3X7P7
PYU1_T013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]