SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013247 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013247
Domain Number 1 Region: 499-575
Classification Level Classification E-value
Superfamily Homeodomain-like 1.2e-21
Family SWIRM domain 0.00078
Further Details:      
 
Domain Number 2 Region: 174-222
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000033
Family Homeodomain 0.01
Further Details:      
 
Domain Number 3 Region: 64-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000194
Family ZZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013247
Sequence length 593
Comment protein Name="PYU1_T013247" Note="Similar to ADA2: Transcriptional adapter ADA2 (Oryza sativa subsp. japonica)" AED:0.063973063973064 QI:0|0|0|0.25|1|1|4|0|593
Sequence
MSAKQAESAVKMEASGARTSPAKKKQRVDASAVSSAPALVVTAAAPSSSASSAAPSGGGK
PVAKSKFCINCQKELTRNIRITCVECISPTTHLPLIELCIECFAVGIELGNHKKTHKYTV
SDCLAYPVVRESQAYMQNMKDAANAPSATSTPQKDSGSGGAATGGAGGNGSAAVLSSDWT
ADEELLLLEGIEMFGMGNWKDIAEHVSTKSEKKCETHYMGAYLSTSDLMPRFLDDPEAPN
ATREKKEAAANGASQPTAASDATAPTTLATGAVAALSTNPGSELAGYMPLRGDFDVEYDN
EAELILADMEFSEDDHPTERELKLKVIEIYNAKLDERERRKRFVIERGLLDYKRHQQSER
RRPKDERELIAQMRPFARFQTPKEHDDFVNGLITAMRLRKQILLLQEYRKNGVRTLAEAE
LYDQEKKKREVDQALQKQRDNAPYLYESGRPVSSGRDRANRWLNRDQGANGSETPNDKNA
HDQDHPRTRGSAAPAGPSSTSSFLIDGTPGSHLLTPQEKDLCSKLKLLPKHYLVIKDALV
RECYRLGYLSKKTAKEIVKIDVNKTGHIYDFFVKRKTQHQKVRQAYLENKLVL
Download sequence
Identical sequences K3X7P8
PYU1_T013247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]