SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013289 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013289
Domain Number 1 Region: 472-614,646-723,800-891
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.57e-66
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00014
Further Details:      
 
Weak hits

Sequence:  PYU1_T013289
Domain Number - Region: 78-355
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00742
Family Rhodopsin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013289
Sequence length 986
Comment protein Name="PYU1_T013289" Note="Similar to PIP5K1A: Phosphatidylinositol-4-phosphate 5-kinase type-1 alpha (Homo sapiens)" AED:0.0453217407695389 QI:0|-1|0|1|-1|1|1|0|986
Sequence
MSPKSSSRSLGAGSSETGTDPDVNMLQASGPPSESLQTCFQSTTRWFQLVMFIAFAVALG
FALSSEYENLSPGLIWGAILSIFSVFFVILSYVSVPGYRQHPNPLVFWRTIADAFFVIQL
LTQQFVRCLFYDCGTLCSGKNPQCGCSEDSGAGHSCDVFAGLFEFSLMAAECWFFCMTVN
LLVSLTNPFTDFKRNTRFFHVFCWGTSLFMGLLLMNTEDWAGYSDLGVCWTNALKNIPPR
DMSTCPTDFKVIDNFSDSYRVVRANIISWAFFYVWMGLILVCSIVVWIWAWKRLSEGMPE
TYAVRVQSINRARFNVFAVTFYWLIVGAVYIKFLSRTDRAKNDTTSELLNFLIAGKGYVD
LVIWFSLNDFRVSHFTKCLSDSPEEVDVDLNPQVNAALRREVLFYTTSGIIQAVQAAERL
PASQRIQHLALLPQNKTTGGVPGNIQSANGVAYPGYMRQNSEDTSAFDENMRVSSKSSER
TKTFHDYEPHAFKKIRERFGVNNEAYLQSLSATAKERLSEGASGAFMFFSADGSLIVKST
SKEETTFLRSIAQQYADYLCSKPNSLLTRFYGCHCLELYGKQFSFIVMANLFDTDQVIHS
RYDIKGSWVNRHGDLPKRGKKVTCRHCNNKYIFQNSLPENANCPLRLGGHEPNVVLKDSD
LTQKLKLDRDVALQLYKQLCADSDLLCSFGIMDYSLLMGINEVEYVVDEGGSFEDAMPSP
VNIGINNRLGDPIVPNINPFTEKSMLDPRSMAQSGGPSGPAFSSTALGASSNGRSNRHHV
SVSSMSSAAADNGRSRKVSRQRDALRNTRSESNASVSSSGRRLPRSGMRMANTVVGPAYY
HLGVIDILQTWTFKKRMERFFKIVFKGVDGDGLSAIQPKLYKVRFQSKLAEILGVEDIVG
TDNADLFTQQNSHMDVDTARTSHFNVQSIRSLPSTDHHFLSSVDSHYADSRSSSNVLRQR
SLEGSHSHSQSVGQDTEEYSGIDYHL
Download sequence
Identical sequences K3X7U0
PYU1_T013289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]