SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013308 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013308
Domain Number 1 Region: 476-566,681-780,1176-1406
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-29
Family Calcium ATPase, transmembrane domain M 0.018
Further Details:      
 
Domain Number 2 Region: 975-1037,1078-1175
Classification Level Classification E-value
Superfamily HAD-like 1.65e-24
Family Meta-cation ATPase, catalytic domain P 0.0071
Further Details:      
 
Domain Number 3 Region: 568-683
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-23
Family Calcium ATPase, transduction domain A 0.001
Further Details:      
 
Domain Number 4 Region: 847-992
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000000000501
Family Metal cation-transporting ATPase, ATP-binding domain N 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013308
Sequence length 1428
Comment protein Name="PYU1_T013308" Note="Similar to Atp13a3: Probable cation-transporting ATPase 13A3 (Mus musculus)" AED:0.00983306654470617 QI:0|-1|0|1|-1|1|1|0|1428
Sequence
MKIQALASLAVAALAPLHVAATASQFDYPACAVNHAPEYYCCDLGTADGASTPTKQLYTR
YNRPDGADFGSYYEEGWKKSRQINWVPNGEKLSMYRPDSPSYVYGDPDNTCRLVATASKG
SIKLKQECTFAPSSGDTRFTQNASLEDGTEGGKVFLTSTPNPRNNNAMFPIGATCEIAKT
DEEKAKCSNAGVPGHYRYTSFKEPAFVFLYVTYGLCFGLLLIWAMVRFALSTSNKAGESG
NLPVAVVVDDGSKKLLDNRGGPETPDITKSVNGPSLAMRATEVQLRHSVEDVEQVGHSTS
YAGKFVLAYFVLMTVFLNIPVILVIRDNQGKYAGKDGFDSWFDPVNVIIKVFIVLWVVSA
VWFALIVIYSDKLLNFFRIPTSLASCDRVTLFKPEKTEVLLADRSGVSQIVNKVEKFLFP
NAREGFEATVPVFTAADGARYLEFQHLRYTYDDVEGKFIPGSVVLSDTYDGILADSQGLS
AAEHTRRLDIVGRNAIEVEMPSIARSVVDEFFSFFYIYQLMCYYVWYFTNYNWVAGLNTV
VIVVAASVNIYAKRGMFSSIVKMTHYQSEVTVKRDGTWVTVASSDIVPGDLVKVTENWII
PCDLVVVKGATVCDESMLTGESMPVQKFPVPNDSTDSYSAEGSGKKYTLFSGTKTLASGR
DEEILAVVQSTGAHTSRGQLVQAILFPAPIKFKYDEHLKAVFSFLFLFGFVAAYLAMKFL
MDNAGLSNTLFAFVYGMFMFSAVLNPLLPVVITIGQVNAAKRLQKQDVFCLNPQRITLCG
KVRVFCFDKTGTITKEGLDFRGCVPVTSGATTEFLPEVNDMIAGSLPVLMKYSLASTHAL
GSLNGELVGNEVEVRMFKSTQWKLIESEGKLPVVRSADDQDQLEFVKRFEFDHHRMSMSV
VMKHTVTGKLYVFCKGSYEKMQSVSKAESVPANYTETAENLAKDGCYVLGIAFKEIDSLA
DAELQAFLSSRDAVEEGLSLLGLIMFRNELKEDSRDALLTLKKGDIRSVMITGDNAMTGC
FIARASGMVDADSNVVLGDMVMDSETGASLVWKDVDSQVVYSSEQIHDLVKFNSSVELAV
TGKAFDYLVKMGEIESLLLNIRIFSRMTPAGKVECVKLHMAAGAVTGMCGDGGNDCGALR
IAHVGVALSDAEASVVSPFTSKTRSLQSIVDLVREGRGALATSFGSVKYLIMYGLIGIGC
RFVMYYNGVFISQFGFMYLDGAILVGLSYSITRCRPQKVLGSERPTSSLVGPTTLFSLVG
AWVIHELFLFGGIKYVMGQVWYCPFSPANVNLVHWWELQDSNLGSSLWFLVCWQQMVTGI
TMSLGSKFRRPVWRNYFLMFYYVLLFVVLCILFLGPPTRFTDQFRVASSTNVVTLPDIPL
PVSFRWELFGIGMANTVTAILYEYLIVLGPVRNYFRAKYHKDVLPLKL
Download sequence
Identical sequences K3X7V9
PYU1_T013308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]