SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013382 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013382
Domain Number 1 Region: 756-966
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-36
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 17-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-34
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 3 Region: 941-1060
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-18
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 4 Region: 238-366
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000171
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  PYU1_T013382
Domain Number - Region: 500-601
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000392
Family Synaptotagmin-like (S variant) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013382
Sequence length 1084
Comment protein Name="PYU1_T013382" Note="Similar to grtp1a: Growth hormone-regulated TBC protein 1-A (Danio rerio)" AED:0.0608294930875576 QI:0|0|0|0.5|0|0|2|0|1084
Sequence
MTTKSLHSSTVIYVNRYFDSHGKTLLHHACRFGKLQVVNALLYHGVNTTAQCEIGRTAFH
DAVSSGNKASTLQVLKILYNHEPTGLNIVDANGTHILHLAAIHGSVDVISWYAKLLSAQA
VSQSSPPPSSSPASGMVASMAITSFSGRNLLHYAAYNGRLQVLRWVLSSENEWNFEFSAS
ALDANGYSLLHYAAMGGHLEVCEWLVFHSSTRNDLNIMAKNSEGQTAFDLAKTPDVKTFV
AQVSQIPPAPTHIHCIGADSCSLGIAWTVEPHSDLLLREILTPLWFELEYCKKPKGLTSA
SGLLSMVMLMPSNTPQFIIKWEQVNVCMQSTAREYWLSGLERDTEYLVRIRAVNRNGSST
YSIPNLATSEFVTTGAGGLRRLLGFFPSYGANASSSVASFIGTLHFELLEARHLHVTLNK
HERSQKKVVVADHGHFYGLINMELPETLMTTPTHRRQTVPIMRSRSKSGASTRRLYRVRT
DNASIQEEMVLSGSLHAFQHPAFQAATTFRVPEASQTTISIEIRHKTHRVDSCVGVVTIS
LMDLIRGLPAKMQWLALQSEHRNAWLSPRAQQQVKVNEPIRGEVLIRTLFLADGITALPH
PTRADVLSASAQELLEDDVETDANYYHDTDGNDSDGDSKSQVTEYRYGPRKSTSASSSSS
KFDSMGFRVLDPRVQQRDSVYVSRKVGGKSYQYYKLLQDCVDRRQLKRWREFHHQSHCEH
GGENCSNSDACAATNLRRSCTLTVPKQLKCPYEARSSNILRELVWNGVPTSWRPTMYLRM
SGALRKSASYPANYFQSLLVRVNRIPNRSTIFSDDEASDDSDADEPADACAGGEFDAVEK
QIQVDLQRTFAGNQCWINSSDGQKALERVLLAYAVHNQSLGYCQSMTFIVGRLLCLFQYH
QDNDDFDDENGLEALQDCEEQVFWMLAVFCEDFFPSYYTKGMIGLQVDGMVLEFLMRKRL
PKVYRHLQQLQTPHIGLLLVTQWLLPICCAVFPSETSFRMMDVLIFEGSHAVFALAIALL
RISQYDILAETKDYMQLFRFLKERDMRLYDTPLLLEIAYAEHALLADDIPSLRNEFANVI
LETN
Download sequence
Identical sequences K3X833
PYU1_T013382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]