SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013386 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013386
Domain Number 1 Region: 78-152
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-16
Family Canonical RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 926-980
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000012
Family Canonical RBD 0.027
Further Details:      
 
Domain Number 3 Region: 482-530
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000407
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 4 Region: 614-658
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000231
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013386
Sequence length 982
Comment protein Name="PYU1_T013386" Note="Similar to Rbm45: RNA-binding protein 45 (Rattus norvegicus)" AED:0.132763777699146 QI:0|0|0|0.66|1|1|6|0|982
Sequence
MADANVAVHAPPSLYPPPEDDAAPPHAHTQDRSVDDTLPQTSAPPATAEASAGTSSSRSQ
SPSPSAADRTRLFIVCGRGRKAEDLRLLFSSCGAIKHLYFALDRSNKSRGFAFLEYEDPS
CAISAIDKFHQLRLDDGHVLKVTIAREKPVIATGKLKRNQQSSHEPRSDSESNSEESHFP
GKRQRSSPPTVSSSTMPAFSRRRTRTKDDEEGNDYKKMHKDETPMQKEAHRGPKITTAQV
PDIASSAADADVKNLLDDMISAIELGAQCTSIAKQRDLASAAAHRFRKQQHRVEREKRPS
ATEESSTDQLTSSISSFTLDATTCSELAKASQFASAASVMSFPQRTERATLLRRRRQSTD
DSDSSLEDVSDTSMSRRKRSNTSHRDSPKWPTTPSPQLPIQRDELELSPSPSLFSPSSST
KKQCKRQSSDQSADVSARSSKQRVTNSRQARMTTDLSATLVERKKTDSPLQIPRSKLFFV
STHKELKAMFAVYGDFEYVEIVKSFGRIKTMAYIKYSDPKTASSVLESFQEDVGRDEEQG
HGGFMKLSLADENLSVTPHLPSRLLHPHGSAFPPAMQPSAASLLEDQTAQEKLWLLILHD
RSLPSQIISSRVSSCPGMEFVDIKVFRSTGESQGVAFVKFEKETQATEAAAELHQLELPA
GSGKFLQAIVILDPSLFSTIHGGPQGQHLGARSMEQGDLRGNEPRVSGGEDVDVSVVEAR
FAHLMRSNDHYNAYPPTARAPMLTEEAAAYQYPMGAPFPAMVPPMHGSQYPGVHMQQLQP
AYGLYPPQQFVQYPSQQLSQFAYVPEASWSSTPSPPPYYHPAHAVNVAHAPAYPGPEYYQ
PSAFPAQLVCPVTSTPDNGTSAQSVVPEATPMSTVASTSEGADGMQSIIISSCRPLELMA
VVKALDECSGVVAITKDGDGSEAAFVVEFSDAAQAMEAVTKLDGKMCNGKKLRVGPMHSS
GKTTRAASSRRKRQRVDQRNRK
Download sequence
Identical sequences K3X837
PYU1_T013386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]