SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013449 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013449
Domain Number 1 Region: 68-177,289-382,762-970
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.53e-121
Family Calcium ATPase, transmembrane domain M 0.0002
Further Details:      
 
Domain Number 2 Region: 386-406,563-815
Classification Level Classification E-value
Superfamily HAD-like 1.21e-53
Family Meta-cation ATPase, catalytic domain P 0.0000791
Further Details:      
 
Domain Number 3 Region: 396-601
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.41e-38
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0015
Further Details:      
 
Domain Number 4 Region: 176-286
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.1e-30
Family Calcium ATPase, transduction domain A 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013449
Sequence length 1002
Comment protein Name="PYU1_T013449" Note="Similar to ATP2C1: Calcium-transporting ATPase type 2C member 1 (Homo sapiens)" AED:0.0548666102085849 QI:0|0.5|0.33|0.66|1|1|3|185|1002
Sequence
MAALPVVANGKRVTYGSGNGVLEIDIHGNVLDDDALTESSSASDLMLDAHIGDGNNSGSN
DIMNTASSLHHDDVVRELGVDPNYGLSPLSVDERQREYGLNELEGEEEESIVAKFFGQFK
DPLIMLLMASGVVSIIMGHTDDAISIGVAITIVVTVAFVQEYRSEKTLEALKELVPPRCH
VVRDGVTVDIFAKELVPGDIILVNVGDRIPADARLIEAIDLEVDESNLTGETHPVVKHTA
AIQNGHLHPIAERKNIVYMGTLVRAGRGRAVVFGTGSRTEFGLVFDVMHKVEERKTPLQN
SMDELGKHLSMFSIGIIAIIVMIGILQGKGLLAMLQIGVSLAVAAIPEGLPICVTVTLAF
GVMKMAKRHAIVKKLPAVEALGCINVICADKTGTITTNKMEVIEIFVPFESVYAEVNGIG
ERPTNTNMSASGAAAASTGIKSHVTMRGEAVTESSHPHVYHCLLAGALCNNAVISDGEVI
GQATEGAVLVCSQKVGVTKEVMDQFSRVSEVPFSSDKKWMAVCCEQNGFRKWYLKGMTEA
ILSRCDKIEDNCGRFKDMSASDRDRIQKESHLMASRGLRVLALAFGEHSDRGMVFSGLVG
ISDPPRAEVEKAIMELHMSGVKTVMLTGDSRETAIAIASKVGIVTPEDLVAADSEDSSFD
DFAVSGTELETMDMMELEKRILKTCVFYRTCPRHKLKIVRAFQEAGLQVAMTGDGVNDAP
ALKAADIGIAMGTSGTDVSKEASDMILLDDNFHTILCAMEEGKSIYHNIKHFLRFQLSTS
ISALCLIAISTLFNLPSPLNAMQILWINIIMDGPPAQSLGVEPVDHDVMKEGPRSKDASI
ITRPMIKRILTSAFCIVAGTLYVFYNELAVDGSVNKRDRTMSFTTFVMFDMFNALSCRSD
DKSVFEIGLLSNTAFAYAVGASLLGQLLVIYFPPLQATFQTEALSMGDLMYICCIASTVL
IFDEGRKWFQGKHKLHASMRSASATGIKKKKRSWQGKAYETV
Download sequence
Identical sequences K3X8A0
PYU1_T013449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]