SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013483 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013483
Domain Number 1 Region: 737-779,863-1055,1121-1206
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.65e-74
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00023
Further Details:      
 
Domain Number 2 Region: 486-557,678-717,884-947,1326-1565,1653-1715
Classification Level Classification E-value
Superfamily ARM repeat 0.00000024
Family GUN4-associated domain 0.087
Further Details:      
 
Weak hits

Sequence:  PYU1_T013483
Domain Number - Region: 178-233
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000139
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013483
Sequence length 2019
Comment protein Name="PYU1_T013483" Note="Similar to Usp24: Ubiquitin carboxyl-terminal hydrolase 24 (Mus musculus)" AED:0.0314356435643564 QI:0|-1|0|1|-1|1|1|0|2019
Sequence
MGYKCFNTYFIGLNAHHKMQRGVAPSDSENTLDVLGIDALWRIAFEAPIDVSELATKELL
RVYERFSEELGGNDEFVDASVKDFLHRAFQKLSEVADPSPASLKLVQQCSNLLSGLATNP
RKKQRFTAHGMAGRGAYFNVKIIAQRIPTSSSSGGGGMGGPNVSPGGSHDNSIRTTQATV
YANQTLWQFRKQLEKVVGHPLQQTKILSGGAAISGDQKTLAELNINETTELRVLMFNTVV
MAYDQDQMVPPGIDAVPAHHPGSIIARNGSYFEILFRVLDIVEGNSVHNLLWEFLKKIPT
ATELLDQVSNIGIQENWDDDVVMDSPVGETNGTMNGTTEDWSSLLKTESQHKAVYTLQIM
DALLLPADSTKIAFARSYLRRFIHGGGFHEVLSYFIKADFHASSFNEGAAVALRILKFCL
FDSGHSDLYFSFAGASKADDGEYAVISPKADAEVTKSKIVIEQASYDNLVQKIAELVVSE
YHRSERNVNSKTTPRILIDAIKTVESIVFIANDAADKYMSTVELQNLIATILMKSESDQV
REQWLSTLQTVCKASKQASTLVFEKVIESVDRIELVTVSCDQYSRLLRFLAQAEGSSLIC
KALAQTVISKLRAGFSNKFLTCNERSVEVLIGYLEFLRDVLIYNVDARDELARGVVEVVY
EECLFTLPSVDRKRGPLCVSLETRRPAFKLLATAISSNAEILHDLQTRLTRLFTKSDTLQ
FKWGQESNVETRGVGDHVGLKNQGCSCYMNSFLQQLFMHPTLRQGLMAAKVTPRPQPKEP
TKAEVEKQPERLVGCRVAVECVGGRVYEANVVGYDDLSGRHTLRYDDGGEASFILAEGRQ
GNENGRYVILQSELTGTEATLEVLRQVQRTFSYLRDSEMRYFNPKALVDSCKCLNLEFSV
YQQNDASEFCDKLLDRLETGLKSTPDGPKCLQAALGGKLISQKLPKDCGHRYEREEPFIR
LELQIRGKESIEESLAGFVEGEVMDGDNKVECELCATKKAAVRRTCFGALPNLLILHLKR
FDLDYTTFETVKLNNRCSFPMDLNMKPYTKAGIEELEASSGSLDDSIADEDAASEEGSVV
SDDFMGEVNGKETSSVVPTSPSSSVKSIVSMSDGNENKLDPNFEYRLKGILVHSGVAQGG
HYYSFIYDQESEKWFKFDDEDVSPFDPANIEAECFGGVQRRSWHGSSNAMEMEVFSNALM
LFYEKVVLVANPDADDGSKAMEDTDEDARYEYEAEVWKSNEAFLQNSYLFDIEFHEFLRE
MVQSKYIKDQNVDPPSPSGSSLPAPPAAPAVLMETRSDETIQTTLTDVGVEFVLSVLLHS
REKHGIARWITVLAAKFAKYKQICVRFFDALSSSRKIQWLRGLVFECPDSIARQSFVHLV
SRALTAYDAHMKVSKDNSDVVVMRRFMETIAEFLDQTSVTQQSHLEECFMLIRNCAEIST
TARESLQGIDMIARLVNFFLSDRAPSVIKEAFPSSHLPPAANRYASPDYQYLLEAIIAIL
GFPRRTTEPLLAETNSQYPHRVTLSEKAEEALTEIFEDFQVNGSLGIEELTKFLRNSVNS
LGSALTSEQNARSIASKYGSREDPQRVELDGFLTYYTDIAAKSTKNVLQDLRAFGFGEDL
KRQSRSLPLASTVLNGLSALSRGALLNDVFFDSALEEDAETVADLLLRISIGDHMTSAML
LRSLLHCMNSTETGWKGQPVIEVCTQVLQSLLSYEFDYQQELIEMALVNPEFGLITTAEN
REKIRQRYVNNNHVPLFVYRQIVIVLELQAKILQVKVWLDAHRREWEWTYEWLRVESLKP
SLGGRLAVLFREPAKLETLHRLGEILNIPYREEERSYIVEGAGFEAVNGIYKSTPHTHDS
CPTYACVKDDIEYTLFRCCMPSKARRWYITYSPNKNLLGTMSDEDYYFVQCHIDMESPPE
EGWKVWSKNEKAIPPTPTVRLYYSTVDDTTGALPTADDDDFGDADDADVDCADVDADADA
DTVEYDDSEDEIRVSNERFQAVHLDNQEDGGSSSADDFM
Download sequence
Identical sequences K3X8D4
PYU1_T013483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]