SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013514 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013514
Domain Number 1 Region: 64-119
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.11e-19
Family Canonical RBD 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013514
Sequence length 129
Comment protein Name="PYU1_T013514" Note="Similar to HNRNPA3: Heterogeneous nuclear ribonucleoprotein A3 (Homo sapiens)" AED:0.640987810004203 QI:0|0|0|0.5|1|1|4|0|129
Sequence
MDGLGVVYEQDDVVAVDATAQQQQPPAQAPTSHGDDTEDDDELRALAVEPDETGGPHGGD
DKGAPQQGKLFIGGISWETTEDGLRAHFGKYGTLTDAALMKDKYTGQPRGFGFVTFADST
ANVVRLIEC
Download sequence
Identical sequences K3X8G5
PYU1_T013514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]