SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013520 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013520
Domain Number 1 Region: 226-282
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000000005
Family Leucine zipper domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013520
Sequence length 534
Comment protein Name="PYU1_T013520" Note="Similar to DNA-binding protein EMBP-1 (Triticum aestivum)" AED:0.129267458905737 QI:0|-1|0|1|-1|1|1|0|534
Sequence
MDASAFPRSASGDDELFLMDDFLLKDDAAFHSNSSNNNGGVSQTHSHSLAGGMETFDHVD
ALLLGFDLDAPLDAAVASSSSTPLEYRQTGMNSTHKSNDGSASPTTTDDMSGSEASSPAP
SFTSEDHHHLKNASPSSSPVRAPPLSQRITAAPMETKYNPAPAAFPRGVLPYALPVAYFP
PQPMVTLNMNQKRPFQPEVLPNAMPPAAITASTSASGDATLTKKSKREIRQMKNRESANK
SRLRRKAQMSELSEEVQELTKKQHELQNTIAALRAENKSLHDQNSFLRSLVAKPNTNNEL
LLQQQQQQQIQQQFSDNSMFADEANFSSLSALENGQQLEIAPPQKKSKTSRVTTFSAASL
SLCASVFGITILSDSEHGASDSGNIRRPGRILHSLPASIDSGFSPAPSTSFLDMIWDTVV
SSWAFLSSSELAFGVLLNVLSFVVIMGLYHMWQASSFTTETTKKQHMIQKSVARSSGKHL
HARNNETKRRSVSWQDIHLRDANGEHEEGDNSRTASSVHGTPQSSRLPRMRDLL
Download sequence
Identical sequences K3X8H1
PYU1_T013520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]