SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013528 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013528
Domain Number 1 Region: 251-400
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000446
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 404-468
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000121
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.026
Further Details:      
 
Domain Number 3 Region: 540-620
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000982
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013528
Sequence length 1327
Comment protein Name="PYU1_T013528" Note="Similar to MCTP2: Multiple C2 and transmembrane domain-containing protein 2 (Homo sapiens)" AED:0.0674301440288843 QI:0|0.2|0|0.5|1|1|6|0|1327
Sequence
MELRQRVRAASASASLHFGRKTVDDPDSVSFWLCEGFKKKNVRGKKNESLETALRQWDML
SILDNPDLHFMNEATGIVVPRGDEIGKFVSDRDVVRICTGDELGKLLEKFACRDLEVDAE
LMGSNKSNTSIGAALFKLRKIGNSNPTIKMIQKTFEDRQSPQGGDEADLLERFPEIDPVF
DNREVEELPKDTPPKCDMCDVSWPDDATGRMHRLTKSGIITHHGCAQFAADVLAHYPDIQ
TREQIIEAPNLSDVNRPGAFHVTVHRAMDLPGVQLLGTQAPYAKLSLLPWKEPFQTKPAE
NGGRNPLWKSMHDNVMQFSHMYNSTITPIPLLEVEIWNSNYISDDLVACTLLDMTPLLRY
PHVEAKRWFTLSSRVQAPIAMMNQSTGQPKVLLSIKFVPFEGSNTSDNEHKFRVHQLKSI
GLAIPNCAVCDRVIMNVIKGAWGYRCEYCGIDVHKACIMKAMTKCECKRLEDTNDSALSR
EKEQLAKATKKKRDDSPVQIERNGSIFKVLNNNVSRLVGELFVNFQGLHLCTKQCQPDKN
FHAKNIFEGDTYCRLIFDDTVHETSPVLKSADPMYHEKVCFKSQNRNSVFRIEIIDFSTD
ACIGEMKITLFQLLQREADRLVRTDPILKKLRDPLRRMSLATHVKDGANDPDRDFFEVHD
PNRYVLTLPASAAKSSNSEKKKIGFALLNVEYIETKKDLLRIRLDEEDLLMKREENDVTV
ETLRNTVDRFSRVIRVFQWADMEYDNIISWKNKKKSAVCVLIFVYCCVFMDLEYAGAYIM
LGILLYMLYQLHLRLEGSFVKRWIGYMDYDLEQINELKLHRPLAELRVAVHEAILSEKTN
EMLKKSQSVLKDMASAKFYVRIKFLPNDKKRAELGGDTIFIPSGYDEAIVAWTHPIDKSK
RPVWRNASVLNSATTHSSSSTLSQFITKQRKEYPFRNFNISWRHNPLVCECERCVSYRVF
QPETLPVENVENPATDQLSDTCGIDHHAFYFPIPQACRKNFTGRNDLAPWRLFPGILQFD
LCISLNGEARETPDLIAASGSIPLRNARSKGSQSTHEMFIPLHTSPSALTDLSPTSMPAS
PANISSQSPDTEEEDRLLVRVEFCPPAANSTDPTRSAATSVTKDENEPKQPLLLQKMESN
APSIVSHAERNLSEFVCESLIEKEASNVIGGHFLDAFWKIKDTLRNVQNEIGNACGIVAS
VENLLNWTHPWKTGVAFTVVLFGFIVFSFIPGRWLVLIFGLSEFGAAFIEDLPPSNHVRN
MLWNFLSSVPTDQDLIDVYDSEREIYLKKQRGRKEREEEETQRLRHHALWTGTVSSKGEH
DRHYKVR
Download sequence
Identical sequences K3X8H9
PYU1_T013528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]