SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013555 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013555
Domain Number 1 Region: 13-97
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000024
Family FHA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013555
Sequence length 785
Comment protein Name="PYU1_T013555" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.0616088650876561 QI:0|0|0|0.5|0.33|0.25|4|0|785
Sequence
MPFLRADLGVASPSSSSLIYELRSSKNLIGSSVAKCDVVVPQTLDLHALLSVSPDKASGS
LVPFSASGEGTCYLNNRTVPLEGARVVHGDRLAFGTVENGFVFELTSQNVSSSSSLSSSR
PSPARAAITGNSAATFRKALDALRGDRSVTSFRASQAKSNGAKASNKVDGTSRRPSSSSV
LSSTKGGQLSKFLLDASSDSQLSEYVERKLRQSAAASRRQRRAPPMAMEPPPSLSSSTVS
SMRSSLEDSILNRMTTANTEDAAQRNSMMTPSVTSRSSNLSTVERNYAEMEKLRLAQQLR
EVNSVLNGEASFSASYLSSRASRSLRGTDEKQHHNIDERASLGDVSDEEVDDDEEEDELP
AMMEKPTPAPRTAAPSVLPNLIPEDAQDDQDAEESTDYLNDSLPGFSEPIRVAQKAEQPR
LASIVARSLHDSASKSEAASPVVSVSKTLHRQRTALHQQLIDQTLRHKRQEIVGHAFVRW
RRGFRIQHQHRQQRAQQLRNLKQKLARVRRNHIFFRWKSWAGMASQVASCRMDAFQQRCD
HRRVMRVWTQWRIQHLIARQRQYLLRSIFRRRFAKSIGTAFHTWTRRTKHLVGQEKWEHA
QQQHQQNWDMRMTKVAESHHSRHHFNPLLTRILRSWHAIAEVQRKKLQALKTIALRGSSK
AKGMAWRKWVELITLSRHTAAVEHEQHTRAQKLLAEQQNKHQQIHSALQNQHAQELQRLH
NQFQGKEHELQRAESKQQQQATELQKLQGQLQNKERQKVVGSTNAWNQSVESYFENAVKQ
TCSMK
Download sequence
Identical sequences K3X8K6
PYU1_T013555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]