SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013582 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013582
Domain Number 1 Region: 6-139
Classification Level Classification E-value
Superfamily Bet v1-like 9.9e-25
Family AHSA1 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013582
Sequence length 142
Comment protein Name="PYU1_T013582" Note="Protein of unknown function" AED:0.439013086650882 QI:0|-1|0|1|-1|1|1|0|142
Sequence
MSEASVQVTVSALVRAPVESAWEHWTTPASITQWNAASDDWHTTKATNDLQVGGQFSSTM
AAKDDSASFEFSGTYTAVEPLKRIEYVLDDHRRVSITFTASSDAETLIEETFDTEATHTV
EQQRSGWQAIMDNYKKFTEAQQ
Download sequence
Identical sequences K3X8N3
PYU1_T013582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]