SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013655 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T013655
Domain Number - Region: 6-101
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00197
Family FIS-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013655
Sequence length 110
Comment protein Name="PYU1_T013655" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.0800637958532695 QI:0|-1|0|1|-1|0|1|0|110
Sequence
MPKSTPPTELERELILAYHNEKLTIRKIAERINRSSTAVHNSLQDPDKYETAKRSGRPPA
LKKRDKRRLKKHASIGDFTANQLEKDLDLQASVHTIQRELQKDDNLVYVK
Download sequence
Identical sequences K3X8V6
PYU1_T013655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]