SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013664 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013664
Domain Number 1 Region: 730-750,833-1056
Classification Level Classification E-value
Superfamily HAD-like 3.56e-52
Family Meta-cation ATPase, catalytic domain P 0.00024
Further Details:      
 
Domain Number 2 Region: 516-600
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-19
Family Calcium ATPase, transduction domain A 0.0057
Further Details:      
 
Domain Number 3 Region: 276-346
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000000288
Family HMA, heavy metal-associated domain 0.001
Further Details:      
 
Domain Number 4 Region: 196-267
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000000589
Family HMA, heavy metal-associated domain 0.0013
Further Details:      
 
Domain Number 5 Region: 479-512,611-726,999-1037
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000968
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 
Domain Number 6 Region: 12-87
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000157
Family HMA, heavy metal-associated domain 0.0014
Further Details:      
 
Domain Number 7 Region: 95-168
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000157
Family HMA, heavy metal-associated domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013664
Sequence length 1117
Comment protein Name="PYU1_T013664" Note="Similar to ATP7B: Copper-transporting ATPase 2 (Homo sapiens)" AED:0.00758426966292136 QI:0|0|0.5|1|0|0.5|2|206|1117
Sequence
MTASSTENSGQHDATMAYELAIEGMMCMKNCGTTVQNTLRGVQGVQSAVVSIETHSARIV
VAPGAHVTADDLIDAVECVGFGAALKSGNAGKKKDPLVVELLVEGMMCQKNCGTTVENAL
RNADGVLSAVVSFDKRMATVTLTHEDSTNEEALIDMVECVGFSASKYDPVKAMKIINQAK
KEAQKDDVVVEMADSPNPRVYFRVEGMSCAACVKAIEDLLHKKQGVLDCRVGLISQKAEI
VFDRDLIRDEKMELAKCIEEAGYKATYSHTVESGEGDTIELKFTVMGMSCAACVGKIERA
VGKLPGVAKVAVNLPLNKAHVHIQQMSTTGPRNVMECITSLGYTVDIDTGTSDQESMSKS
EVKKWKKLLLTALLFSLPAMMIHMVLGYIPFVHHFLMTPIINAINLKMLLMFLLATPVQF
WIGKRYYVAAYKGLQHGMMGMDFLIICGTTASYIYSFVSFVGSGLSKDYHGHHFFESSTM
LLTFVTLGKYMESMAKGKTADALSELAKLQPKTAILIVEGESDREIPIELVQRGDLLRVP
PGANVPTDGIVKNGSSACDESMLTGESMPVAKTVGDYVFGSTINQQGTLVIESSCFGGES
SALSQICSLIEDAQLHKAPIQAYADRLASVFAPFVLGVSMLTFFSWYILLTTDSIPHQWK
LDLGLNPEDGHTNDLFISILFAISVVVIACPCALGLATPTAVMVGCGVGAKQGVLIKGGR
ALEIAKYVDTIVFDKTGTLTVGHPSVTDVIISDRSFSPREVLYYGGSLECVSEHVLGKAI
VITATEQEKLQLKEPAQVQVVPGRGIEGIVPRWKEQALGPDVNVMVGNPEYCEEKRIEIG
AKIREQMHELEMEGKTVVCVCIEGKLCGVIAMADTPRPESKAVVSYLKSMGLDVWLITGD
NIRTASSIARKMGIDHVKAIALPGEKAAQIKALQSRVSPITKKQRVVCMVGDGINDAPAL
AQADIGMAIGAGTQIAKAEADMILVKSKLTDVVVALDLARVVFFRIRLNFFFSIAYNFIG
IPLAAGIFFPILHSTMPPACAGLAMAFSSVSVVISSLLLKRYRAPEVCELKPSKYDEDTK
VIELKKMVRTRLNTAKQPYAPLSNVDEVKQTHHSPRQ
Download sequence
Identical sequences K3X8W5
PYU1_T013664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]