SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013689 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013689
Domain Number 1 Region: 32-201
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.45e-47
Family Canonical RBD 0.0000922
Further Details:      
 
Domain Number 2 Region: 207-399
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.31e-46
Family Canonical RBD 0.0031
Further Details:      
 
Domain Number 3 Region: 512-629
Classification Level Classification E-value
Superfamily PABC (PABP) domain 1.57e-31
Family PABC (PABP) domain 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013689
Sequence length 630
Comment protein Name="PYU1_T013689" Note="Similar to pabpc1-A: Polyadenylate-binding protein 1-A (Xenopus laevis)" AED:0.0318585241393696 QI:0|-1|0|1|-1|1|1|0|630
Sequence
MANSSTSPTNSPATTAASSATGAAAAQPFHTASLYVGDIHPDVTEALLFEIFNAVGPVAS
IRVCRDAVTRRSLGYAYVNFHNVADAERALDTMNFTSIKGVPCRIMWSQRDPSLRKSGVG
NIFVKNLDTSIDNKALYDTFSLFGNILSCKVAIDNTTGASKGYGYVHYETAEAAHEAIAK
INGMLIAGTEVFVGHFQKRQDRPDIDDWTNCYVKNIPSQWSDEDLLKEFKPFGPVLSAVI
MRDADAELNRGFGFVNFEESEGAHKAVEALNGKVYQTADGSDLELYVGKAQKRSEREREL
RNKFEQLKMERINKYQGVNLYVKNLDDQLNDDELREAFASAGTITSSRVMRDQNGNSRGF
GFVCFSTPEEANKAVAEMNGKLISGKPVYVALAQRKEVRRAQLEAQHAHQRAGLVVGRGL
PMGQPPMYGAAPMFYTQPNQMPPQARQGFVYPQQMLPRGVHPRGPIPYGARAPGAPAPGP
GGYHMPAYGMPMQQQRGQQRRGRQGPGPAGPQGPGAVNRRNFKYTANVRNQPPREGAPAP
GAPPAAPVQVGGPEPLTSAALAAASPDVQKNMIGERLYPLIHRQQPELAGKITGMLLEMD
NGELLHLLESPEALEAKIQEAIQVLEAHQS
Download sequence
Identical sequences K3X8Z0
PYU1_T013689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]