SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013697 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013697
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily YjbQ-like 3.14e-36
Family YjbQ-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013697
Sequence length 112
Comment protein Name="PYU1_T013697" Note="Similar to SPAC4A8.02c: UPF0047 protein C4A8.02c (Schizosaccharomyces pombe)" AED:0.100968188105118 QI:30|0.75|0.6|1|1|1|5|208|112
Sequence
MANLFIKHTSASLSINENCDADVRTDMEAAFNRIVPETWNKEIFRHTMEGDDDMPGHVKS
TLIGASLNIPITNGKFNLGTWQGIYLCEHRNAGGWGGGHERKIVITIQGTTA
Download sequence
Identical sequences K3X8Z8
PYU1_T013697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]