SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013710 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013710
Domain Number 1 Region: 86-209
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000344
Family FHA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013710
Sequence length 215
Comment protein Name="PYU1_T013710" Note="Protein of unknown function" AED:0.307795698924731 QI:0|0.2|0.16|0.33|1|1|6|0|215
Sequence
MKRKQQHEEDDGAEDSNKKPKGGDAVSEVTEPNSVEVVVDVEGFFERECEMEAQKLREHA
KARCADLRRELAKSRQAIADSFVTEKEAWLSQQDASDGYDVRIKCVSGPYEGSTYVLKLD
SKKHRTCLIGRSTGRKFRAPNGLSMPKDPELSTTHAQLRLEADGRVFFTDLDSTNGSYIN
DESVEPHEPQALSTTEPNKVSVGGSELLFTFTKRV
Download sequence
Identical sequences K3X911
PYU1_T013710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]