SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013736 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013736
Domain Number 1 Region: 206-312
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-27
Family Canonical RBD 0.0000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013736
Sequence length 324
Comment protein Name="PYU1_T013736" Note="Similar to TIF35: Eukaryotic translation initiation factor 3 subunit G (Magnaporthe grisea)" AED:0.0136319376825706 QI:24|1|0.5|1|1|1|2|0|324
Sequence
MVVSGSRWGDDDDDFLPQRTESEPDQNGVRTIVEWKYNEDGQKVKVTKKVKKVTEVTRVS
KRALERKNWEKFGAAKNDGDNSNVTYQSYEEVRLEDPNADQVLPGEKKEEENIFAGVKNS
SIVVCRHCGMVGDHWTLKCPYKDTPADELPSDLSTRAAADAESGAAAAAGGDAGGSALSN
AFGSGKYVPPSLRGRVPEGGGGGGDEEDRDFATLRVTNVSPDTREDDLKELFRAFGPVAR
VYLAKDRETFESRGFAFVSFMHREDAERALNKLQGYGYDHLILKLEWAKPSNKPKETDAG
SMGTTFRSGYGKALPQNIAPPPRK
Download sequence
Identical sequences K3X937
PYU1_T013736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]