SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013768 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013768
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.07e-27
Family PLC-like (P variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013768
Sequence length 145
Comment protein Name="PYU1_T013768" Note="Similar to DDB_G0272092: Probable serine/threonine-protein kinase DDB_G0272092 (Dictyostelium discoideum)" AED:0.0342465753424658 QI:0|-1|0|1|-1|1|1|0|145
Sequence
MGKFRVRVILYKCTDLLAADSEVVGGKSDPYVIFSVGNVTKKSSCIMNTLNPQWSPPEKF
EFDVADWESEFIVVNVFDYDRFSRDDLIGSAVIPLALYTGDRHCEMYSYPLVLPDELGGP
GSPKSDIFLQITLTTKDGNTVETYY
Download sequence
Identical sequences K3X969
PYU1_T013768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]