SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013808 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T013808
Domain Number - Region: 708-817,957-999
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00602
Family Calcium ATPase, transmembrane domain M 0.052
Further Details:      
 
Domain Number - Region: 165-191
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0123
Family Canonical RBD 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013808
Sequence length 1067
Comment protein Name="PYU1_T013808" Note="Protein of unknown function" AED:0.190543071161049 QI:0|0|0|0.5|1|1|2|0|1067
Sequence
MAKRAAALAKLDRLAAGSKSVFDADMNDIGALGIGMQLYFMLTKYLSITFLCMGVIALPT
IVVNYFGNGVTDKLVDPLQLAYASLGNQGVSPDIASDPKLCLPKGDIDCTWKTVNTPFTS
NPETVSWLITIADCIYSTGFLLFCLVYRYHAKKAIELHSTENLTPAKYAVYVRGFPPDAK
EQEILDHFNALYDPTKEDEYFPLWLSCCWGKRRKVNKALAAATKNQKAANMCVVTNVDHL
AATTATNKEIYLNTWIAEVSIGHPTGGLLRTFLSMEALTRSIAETQELIQILEQEKVAAA
AGAVITPMATKGGKASTKPPKKVTFKAGDQKLLTQAKEKLEKLNAAMEKKTSKIKAFKQT
NATLGSPSKATAAVDPMQDGEVKVKSNAASAKRLAKAARKAATATEKAFNWDACQCAFVV
FNNLESKRRCLRDYRKSTWWLPHKYQPKLLRFRSGQHRLIVEQAPEPSNILWENLEITDR
GRLYRRSFTNFVTFLLLLFSCAIISGAQSAQQTFKSKMPPAGLCEWSLPQVFYGSDSFDA
NSKLAWDLQWDQNATCDPGTNNETRYHIAYTNGIVNAFNFTNPAVVAAGAASPVRCVDPC
VSDSSATTCSTLPCFNQDLVDEGDVCETYLASHILYCLCTDALTTSMDDFGFIDGPKMLW
ETYTPCRGFITDYLTKNAFIVVAAGIVVIVNLLLKAILRAFANFERHSSESAKASAIAIK
MFSAQFLNTAIIVLVVNATLGLNKIPLAKELFNGKYRDFEREWYPTVGMGITMTMLINAF
VPQLLLFVQMFVLAPIRRCLTRRKIRTQHQMNQLYAGPQFDIAVRYPMILNSVFVTMVFC
GGSPVLLFIASIAAAGTFWLDKLSLLHMYSIKTTYDEELGEIALQILPWTLVLHLGFSTW
MYGNTTLMKSATIDLTALLQFFGYKATSASSDPNAVYQEFLDKATKIDILGENGFVVKVV
HSNVMTVFVFFLIVLVGIFLSTLWLQVLLPILKRTLFLILQAIWKRLKPRLARATARLAW
KRKKKVEKLQKSAKVAVDLPTPAEVAEAPALLKCLRHQRHPQGQIHQ
Download sequence
Identical sequences K3X9A9
PYU1_T013808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]