SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013856 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013856
Domain Number 1 Region: 486-786
Classification Level Classification E-value
Superfamily DNase I-like 7.33e-47
Family Sphingomyelin phosphodiesterase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013856
Sequence length 790
Comment protein Name="PYU1_T013856" Note="Similar to sph: Sphingomyelinase C (Leptospira interrogans)" AED:0.10047545759358 QI:0|0|0|1|1|1|2|0|790
Sequence
MPQVDGPLIAPEYASTAHDPVRSPSARASARRPLRRAPASLPTRGLRPSESLSAIFTRGA
GSSAAADQAAVDDGAAPEESEFVCYGDRVCFLCEGQLLALTRKFNLTYNQMALLVLLTLC
SGGTFGIAGLLIWKKGLLRKRYAALFSDAIYADNASGDANDSIVDADGHPLAMHAKMNAE
DSEYDLRESHRRSSMAETIPGSTTSGVDTAATKNASGNDRVDPRKPVTFRVFEYDAENQT
IKLESVGKPVEFGAQVIVVHAATQRAIKYKPHRGAVTLSKPLKSLHFQKDVMANLPTLQK
SSISSNRHSMPGERSTGGRFYRSMSEACMTFANDVQESIHDTLHRQRDDKKRVKQLIKDL
PNMSFANSSGKYFVATVQPVKHHLGGGSLARQGTGSTGSSSSSGGFASLLPQTERFLRWG
APMAIIADYNGKACGIRPRQYYKDCQLYLTTETSQTTIIPLREDGDLQSMAKESTRLLAH
IEKRQVQLSVGTYNVWMMPRIVSAFTSVSPKKNTRARLIADVLPPCDVWVFTECFDHRAR
AILLDKLKAAGYFYFSPTVGHKRLKRENMRKVLNGGVVLASKYPIVTVRIKLFKEACLGA
DKLADKGVLYCKILKDGLPVHIFSTHLQAWSDPLSRAMRRAQMVMIADFMRAMAIDEVND
PVLFVGDLNVNYWLNKTDHEYDEMLAIFNASDPSVVLQNAQRQTQQTDLKLMRQFSFDPR
LNALAADGLSTDGSLELLDFVLYSKAHRQPSAAKSWIVPLTTATPWNWRKQPQYNLSDHF
PVVSAFTFDM
Download sequence
Identical sequences K3X9F7
PYU1_T013856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]