SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013867 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013867
Domain Number 1 Region: 117-205
Classification Level Classification E-value
Superfamily Homeodomain-like 2.45e-24
Family Myb/SANT domain 0.0043
Further Details:      
 
Domain Number 2 Region: 68-129
Classification Level Classification E-value
Superfamily Homeodomain-like 1.72e-17
Family Myb/SANT domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013867
Sequence length 207
Comment protein Name="PYU1_T013867" Note="Similar to MYB: Myb proto-oncogene protein (Gallus gallus)" AED:0.162377994676131 QI:0|-1|0|1|-1|0|1|0|207
Sequence
MDQYSKRERPDSIRELTKSEEKALQRTRSEHESAHSDSPTRGSLSDQEGTEAGEGGAEEA
EDPDAPTTKRWTKSQDSALRESVRIHGEKNWKAIAELVPGRNHAQCLQRWRKVLKPGLVK
GHWSFEEDQVLEFLVTQGCNNWGQIAERIPGRTPKQCRERWKNHLDPAINKGPYTEDEDS
IILSAQERLGNKWSQIAQLLKGRTEDS
Download sequence
Identical sequences K3X9G8
PYU1_T013867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]