SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013907 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013907
Domain Number 1 Region: 277-344
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000185
Family Centromere-binding 0.032
Further Details:      
 
Domain Number 2 Region: 73-140
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000113
Family Centromere-binding 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013907
Sequence length 363
Comment protein Name="PYU1_T013907" Note="Similar to cbh2: CENP-B homolog protein 2 (Schizosaccharomyces pombe)" AED:0.081043956043956 QI:0|-1|0|1|-1|1|1|0|363
Sequence
MPSSERIVLTDGQRQQIAAKAAEQGQQWTNEQLSVWAAEAFRLDRPLHRTTISKILKRKD
EFKGLTSAQMNQKRRRAVANREFDDALAAKVRRFREYRAPLTDSGIVQLGVETYDEMRVP
EEQRVSLSTGWLSKFKARHGLGGKARQTLTSGMEHVVCTHGQQQQQNVNAPHIVHADGQR
QQVMVMAKASRKCRADRRRRKVAKPPNVERIVLTDGQRQQIAAKAEEEGQQWTNEQLSIW
AAETFKLDRPLHRTTISKILKRKDEFESLTSAQMSQKRRRGVGNSEFEDALVTKVRRHQE
CRMPLSDNAIVDLAVETYEELHVPEENRCALSSGWRSKFKARHGLKFSRERGETAAAKRR
KPH
Download sequence
Identical sequences K3X9K8
PYU1_T013907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]