SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013921 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013921
Domain Number 1 Region: 290-387
Classification Level Classification E-value
Superfamily Homeodomain-like 4.77e-27
Family Myb/SANT domain 0.0049
Further Details:      
 
Domain Number 2 Region: 239-306
Classification Level Classification E-value
Superfamily Homeodomain-like 6.76e-17
Family Myb/SANT domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013921
Sequence length 845
Comment protein Name="PYU1_T013921" Note="Similar to MYB: Myb proto-oncogene protein (Homo sapiens)" AED:0.137048495258345 QI:0|0.62|0.44|0.88|0.87|0.88|9|165|845
Sequence
MAELMQANGGDAGTSSSLAAVSASHVSELGKALDQTTISSASVTGSLTDASQACDDDDEE
DEDDADEGDEEDDYEEDEYAAGEYGTHEDDDDDGAGTEDGDDFGMAGPNGDDSDDNGNAA
SSLHDGSLTAAATSANAGAAAPAPLKNLPTKSQKRGRTDSLKKMLPAPASQRHKQKNGDD
LSGECTIEDALLSGVVPKPQPAKLLVKDRTGAGMGVPRPHLIINAVKQAPPAKEKSNPRR
WSKHEDESLRLAVERSGERNWKAIADQVPGRNHTQCLQRWTKVLKPGLIKGHWTPEEDSK
LRELVTEEKKNWGQVASLIPGRTSKQCRERWCNHLDPNINKGSYTEDEDKIIIEMQAKLG
NRWSIIAQQLKGRTEDAVKIRWKSLMRGRRAAMKDEKNHPGASTTSNSSSIASSPAKESA
SSGFSSEKPKPKATKSTPARQKTRAASPVVKLENDAVGSASVDHQAMNVTSAAASMVPTP
VDLEPADLSSVGSSLSAVDGLDPAELAAAMSSIQSVNDDLVATSIHNFQMSQRFHQQHGG
GGNLAANAGGGVFATNAQNVSQTISPVNHAMYSTSSNGYNANVNLSAQPNSFHVQQQQQQ
GFNPMQSASPAMGQNYGFGVASQMTMSQQQMQFYNGLPNGMNATGAQLPNQNFNSAAMQA
NMYANFALNTPSGDVPGGLPPTSNGMNIGLPPSSAAAAAKMLNTPREEWGSSQTPRSQMI
LTEGHASAYELFHQQRVRLMLQEREKHGLTLSSAPSPGQAMLTKELEANKERQKRQAIMQ
KGWKSAVEAMIAYNSDISALDDGQGFDGFLEKVTLSGLDPTDEELIGDIMAGDDAIDIIE
TPVGE
Download sequence
Identical sequences K3X9M2
PYU1_T013921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]