SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013945 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013945
Domain Number 1 Region: 245-334,483-577,1159-1374
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-39
Family Calcium ATPase, transmembrane domain M 0.035
Further Details:      
 
Domain Number 2 Region: 578-594,751-841,900-959
Classification Level Classification E-value
Superfamily HAD-like 5.19e-29
Family Meta-cation ATPase, catalytic domain P 0.015
Further Details:      
 
Domain Number 3 Region: 589-805
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.81e-16
Family Metal cation-transporting ATPase, ATP-binding domain N 0.014
Further Details:      
 
Domain Number 4 Region: 334-432,459-482
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000000144
Family Calcium ATPase, transduction domain A 0.0042
Further Details:      
 
Weak hits

Sequence:  PYU1_T013945
Domain Number - Region: 987-1026
Classification Level Classification E-value
Superfamily SAP domain 0.000201
Family SAP domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013945
Sequence length 1449
Comment protein Name="PYU1_T013945" Note="Similar to At5g23630: Putative cation-transporting ATPase (Arabidopsis thaliana)" AED:0.107011494252873 QI:0|-1|0|1|-1|1|1|0|1449
Sequence
MAKAEAPRWTGKSIRKLSLHRRRVNPMNLGYGLEHVPFLFLYAYSLYYCLLTIGEPYAQA
IKELEESGVLLPQSGAGGDAVDDGLLSGLAASTLSQGSVRDVSSGINYTELQDQEEGPPL
PNPFLPAIVPLLYLLFTVVTHGLMVLFQVWSVSVLAFIKYTPAQTLEDATFVLVVPRSFK
GKSSIIKLEKPAKTADGRQPTPFFVFQKRKYIAEVDAEGTVTFCKLMAPTTKLVKEYVST
KGFASDKDVTAQLDLHGKNEFSIPQPNFVDMFKQQLLEPLTVFQVFSVCLYMLDEYWQYS
LFTLAMILMFEGVTVMSRLKNLQTLRGMGNQTRELYAFRKNEWVKIASDLIVPGDIISIK
RETEGDVDNSVPCDCLLLDGSAVMNEATLTGESVPQMKEAIGSKMSEQDLNEVLDMKSNH
KVHVLFGGTTIMQSDTSNVTYDHASSSASATKHIPASPDQGCIVYVLRTGFSSSQGKLVR
MIEYSSGKVTGSSWDAYGLAFLLLIFALLSSGYVLRHGIAQKGKITFELLLRCVLIITSV
IPAELPMQTSMAVNSALLNLVKLSIFCTEPFRISLAGKVDICLFDKTGTLTTDQLTAIGV
VCEDGAAKTTTTTEVLGHVPMIASNLDSSLVLAGCHSLVQIDGKMVGDPVEEASIRAIDF
SYDATTRRCQAKPDSDRASERRWGAGVSQKDVFVQILHRNHFASKLQRMSVVAKVHLGDK
GIRYRSLVKGSPEAVSALLCKDAIPAWYWPTYQSLARKGMRVLALAYKDIEGKPTEQDIV
QKPRSWAESDLQFAGFAAFQCLVRKDSGEILKQLKDSSHRVSMITGDATLTAVHVSKEVG
IVTRPALILSEGASEGELVWTRAEDDSKVDAYKSSDIPILEKKYDLCVNGKTLAAASEID
DVIWKHMHHIRVFARMTPELKEKVLTFLKKNGHHTLMCGDGGNDVGALKQAHIGVALLGG
FGSANADKSVTGVSKFQKGGAVTVSTREELMKLHASVLKKRLAQMKVDASTCKEKKDYVE
LILAMEKKKADEKKVVKKVNPLVKKAPTKEERDEIMRKKQAEIEADVREREARGESFARI
KAIAAFAKREAEEGKRQAAERTGAKGFANFANNAAMHQYMDDFEDGEVPMVKLGDASIAS
PFTSRAPSIKGCVDIIRQGRCALVTTMQMYQILAVNCLISSYSLSVLYLDKVKYANSQLM
ALGMISTVASVTLSRATPLPNLSPVRPLTSIFHPALFSSLVGQFALHLGCMIYLTNLAKE
YTPPGDITHSRAGEFKPNVMSTVIFLINGVQTVSVCAVNYKGRPFMKSMTENPGLLYSLG
ISIVGVFLLCTEAMPLFNKVLQIVPMPDPRFARMLTGILALDVLGAFIWDQICLLVFAPK
IFFASITSMEVKDFRQLLKMGVISLIIIYILANIDYDEIERQQKLLEEQAVMTAEAEAAG
DPFVQGISA
Download sequence
Identical sequences K3X9P6
PYU1_T013945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]