SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013951 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013951
Domain Number 1 Region: 33-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000421
Family Psq domain 0.027
Further Details:      
 
Weak hits

Sequence:  PYU1_T013951
Domain Number - Region: 258-297
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000113
Family Psq domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013951
Sequence length 506
Comment protein Name="PYU1_T013951" Note="Similar to SER1: Sericin-1 (Fragment) (Galleria mellonella)" AED:0.00887573964497035 QI:0|-1|0|1|-1|1|1|0|506
Sequence
MPGSKKASSPTPSTTSSPAPDLAVLSISAMPRSSTVSEDVWAKAIHAVKVQKMSLRQAAQ
MYGVHHMSLHRRVRGRYATSVASSFNIKSYLNEDDEAEVLGVLREQFLHEKRITSDDIRF
VVRAIASHGGKRSVPPEFPPSRWIVEFKRAHGFAKLNSYAYPPVSNGSDGDMDDGDSEGS
SYPRYAVPSYRSGDREQQDNGQSSQWERNSDGDREDFGSNTSSGSSYDTGTTGSSCGSYE
NSSQTEKRSYKLSHTVPPETWEKAIAAVEQQGMSLRTAARAYGVHFAALHRRIKKRAQGD
QSSNIEGYFHPDDEAGIIRVVIARAELGVLMTFDELMDLVQRAALRNLPDISVDAARKLM
ARFQSRNEHSIRHIIVDWPLPRIGAMNVNNNSSSGVMAGTNGTTDARPIRIPPRPSVIVS
SGDPAATLMHRVPLIPPPMIPGGVNGNNSSKSVALTAPLRAPAELPSAQALMLRSAQQQQ
IPPPPLSSLNKRDKTARATGHPIMFV
Download sequence
Identical sequences K3X9Q2
PYU1_T013951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]