SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014006 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014006
Domain Number 1 Region: 51-272
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.4e-19
Family Lysophospholipase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014006
Sequence length 287
Comment protein Name="PYU1_T014006" Note="Similar to C05D11.7: Uncharacterized protein C05D11.7 (Caenorhabditis elegans)" AED:0.065010271032622 QI:0|-1|0|1|-1|1|1|0|287
Sequence
MVLMWHGGMRLLLQRRSAARYAAFGSSPLLYQYSTSAPSSSPSPAAAQTHNFAFSGSGFL
ISYHLGVAQGLHESGFLTPQSKVAGASGGSITALAIAADVDLLEIHDEAKKMVALCREEG
TLWKLEARLRVIFNQIFASTSVDVLNKRLTIVTQQVWPKRQTERWDHFDSIADAGNAVIA
SCYIPFYLARQGATKFRDGFHVDGGLLDLVPDIPGYVKVCAFHATMLRRKDYAISPSLVP
NFPYSIWELARASLVPPDAAMLDELFEWGKQSAFLWAAAQKSEEQAK
Download sequence
Identical sequences K3X9V7
PYU1_T014006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]