SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014017 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T014017
Domain Number - Region: 22-79
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00129
Family Lambda integrase-like, catalytic core 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014017
Sequence length 197
Comment protein Name="PYU1_T014017" Note="Protein of unknown function" AED:0.137362637362637 QI:0|0|0|1|0|0|2|0|197
Sequence
MSTRFVIVNPTCANVDDEFQFRNVTAKMINTILSNVCGQAGAEELSKFISHSGRRGCASE
ALSHNGVSVTKVIARRGWAFDAVSRVFLYLCGCDNGDMRVGRVVAGWPETDKEDTTKCQL
TEVDRTSFRALAIELYKQCLSFYDASILEVLTASLVMYYNGVRHKWAKMDREDVLLLFTS
IEAAACRVGVSKRDLSN
Download sequence
Identical sequences K3X9W8
PYU1_T014017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]