SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014026 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014026
Domain Number 1 Region: 355-467
Classification Level Classification E-value
Superfamily Bromodomain 3.53e-34
Family Bromodomain 0.00027
Further Details:      
 
Domain Number 2 Region: 1130-1211
Classification Level Classification E-value
Superfamily TAZ domain 2.22e-19
Family TAZ domain 0.00029
Further Details:      
 
Domain Number 3 Region: 1037-1103
Classification Level Classification E-value
Superfamily RING/U-box 9.65e-17
Family ZZ domain 0.0034
Further Details:      
 
Domain Number 4 Region: 552-576
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000104
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014026
Sequence length 1259
Comment protein Name="PYU1_T014026" Note="Similar to HAC12: Histone acetyltransferase HAC12 (Arabidopsis thaliana)" AED:0.103730698628658 QI:0|0|0|1|1|1|2|0|1259
Sequence
MNECRQLLQRSHTTQDLNVKSEYEKQVNEKRVLLKTLDAKAKRCSSQHRIVKHIINTRTA
SSSSSAASGGMASASRPPTVGTAPTPPTSVAQLPPSAMQPIAMPPHIQAPVQPFTSQPQQ
AVQDMPLVQMPSQSPMIMASQMATTPVGQSVPKQSPDDILAEEIQIPIGMTLGAAGKPLE
MPPDLQEPMTANTFGAASATVAAVSGAQEKVIKTEASAPGMGFANGSVPQQTPLNPPANA
GVKPAAPQVKEDAINPLTMNNSKLNAMMKEHQRMDSAGVVKVEPNNAAAAAPTAQPENPL
AMNGAIVPAVGTSAGVTTPSGTAATDAPTSMLNELSNEDLEAHINSLTKYYNATMSPTLL
KKRLEGLLKGMMEHKFGWVFSSPVDPVALGIPNYFKIIRRPMDLGTIKKKLDLGIYKNIH
QFAADVRLTFNNAKTYNSEEQDVYNLAKDMLADFNAELRKLEVEVNEEERAVREKESSCR
LCGVERLVFEPAVLYCNGECNSRIRRNCYYYTSSDNKYHCCHPCYGNLGDSVKHSEGRTY
KKAELSRKKNDEVHEEPWVQCDKCNRWVHQICALFNGKIDAEKKPQQIKSENSKGNPGTS
SAASTPSNGSSNSKDGNVVSAHSISSTPGSEFLCPECLLDHRKKEPQKYKIGRHAFNAKD
LMRTKLSDFLERRIYKALQDEREDEAKWTNRDVKDVQTVESLTVRLVSNIEKQLMVRDKM
FQRYKDSHKYTYEHRFKSKCICMFQEIHGVSVLLFGMYVHEFDEQEADCNSRRVYISYLD
SVNYFEPAHLRTKVYHELLVAYLDFVKQRGFHTAHLWACPPLKGDDYILYCHPESQKTPK
SDRLRQWYVDMLVKAQDEGVIWQITNMYDDYWRNDNSACALPYFEGDYWVGLAEDLIEKI
ESEKPKKTKKANPLMVKLGEVIEPMKDDFLVVKLYPCCRICNSTVLQGATWQDTTTKTEI
GLNPKVVQTVLCDACYEKAKLTPKLQTRLNVLTCTEMDIPLKCTDPDEVNDSEFFDTRQA
FLSLCQGNHYQFDELRRAKHSSMMALYHLGNPNPNAYIYECNACTQDIVTGNRWHCHTCP
DFDVCDACYEKEKHEHPLEMIPTSGVSGSKGGAHGSGHAALTEEQRRVQENRAKNVRLHM
QLLVHSSTCANGSCGSSNCEKMKELMRHGAQCKLRAYGGCTICRRVWALLQLHARQCREY
ECKVPRCHDLREHVRKLQLQQQLMDDRRRAAVTHQYRQMKGGGEEQPNESAEDEPLNGA
Download sequence
Identical sequences K3X9X7
PYU1_T014026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]